| Catalog# | 
            C174 | 
        
        
            | Source | 
            E.coli | 
        
        
            | Description | 
            Recombinant Human Stathmin/STMN1 is produced by our E. coli expression system. The target protein is expressed with sequence (Ala2-Asp149) of Human Stathmin. | 
        
        
            | Names | 
            Stathmin, Leukemia-Associated Phosphoprotein p18, Metablastin, Oncoprotein 18, Op18, Phosphoprotein p19, pp19, Prosolin, Protein Pr22, pp17, STMN1, C1orf215, LAP18, OP18 | 
        
        
            | Accession # | 
            P16949 | 
        
        
            | Formulation | 
            Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4 | 
        
        
            | Shipping | 
            The product is shipped at ambient temperature. | 
        
        
            | Reconstitution | 
            Always centrifuge tubes before opening. Do not mix by vortex or pipetting. 
            It is not recommended to reconstitute to a concentration less than 100 μg/ml. 
            Dissolve the lyophilized protein in 1X PBS. 
            Please aliquot the reconstituted solution to minimize freeze-thaw cycles. | 
        
        
            | Storage | 
            Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. 
            Reconstituted protein solution can be stored at 4-7°C for 2-7 days. 
            Aliquots of reconstituted samples are stable at < -20°C for 3 months. | 
        
        
            | Purity | 
            Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. | 
        
        
            | Endotoxin | 
            Less than 0.1 ng/μg (1 IEU/μg). | 
        
        
            | Amino Acid Sequence | 
            
             MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHE AEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHI EEVRKNKESKDPADETEADLEHHHHHH 
             | 
        
        
            | Background | 
            Stathmin (STMN1) is a ubiquitous cytosolic phosphoprotein which belongs to the Stathmin family. STMN1 is expressed in many tissues, with the highest expression in the brain, spinal cord, and cerebellum. It can also be expressed in the colon, ovary, placenta, uterus, and trachea. STMN1 participates in the regulation of the microtubule filament structure by destabilizing microtubules. STMN1 promotes the disassembly of microtubules and prevents assembly. STMN1 is involved in the control of the learned and innate fear. STMN1 is an intracellular relay integrating regulatory signals of the cellular environment and as an Oncoprotein in regulation of the cell cycle. Phosphorylation at Ser-16 may be required for axon formation during neurogenesis. Mutation in STMN1 effects cell homeostasis that may lead to tumorigenicity. |