| Catalog# |
C635 |
| Source |
HEK293 |
| Description |
Recombinant Human Syndecan-2/SYND2 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Glu19-Glu144) of Human SDC2 fused with a polyhistidine tag at the C-terminus. |
| Names |
Syndecan-2, SYND2, Fibroglycan, Heparan Sulfate Proteoglycan Core Protein, HSPG, CD362, SDC2, HSPG1 |
| Accession # |
P34741 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM Tris-Citrate, 150mM NaCl, pH 7.0 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
ESRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGADEDVESPELTTTRPLPKILLTSAA PKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNVYTEKHSDSLFKRTEVDHH HHHH
|
| Background |
Syndecan-2 is a member of the Syndecans family comprised of type I transmembrane heparan sulfate proteoglycans (HSPG) that are involved in the regulation of many cellular processes. Four sub-types of mammalian Syndecans have been reported and among them. Syndecan-2 plays a role in the cancer development. It can affect the basal and chemotherapy-induced apoptosis in osteosarcoma. It can also suppress MMP2 activation, suppressing metastasis. |
