| Catalog# |
CG30 |
| Source |
E.coli |
| Description |
Recombinant Human Tachykinin-3/TAC3 is produced with our E. coli expression system. The target protein is expressed with sequence (Gln17-Glu121) of Human TAC3 fused with a His tag at the N-terminus. |
| Names |
Tachykinin-3, ZNEUROK1, Neurokinin-B, NKB, Neuromedin-K, TAC3, NKNB, UNQ585/PRO1155 |
| Accession # |
Q9UHF0 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM Tris, pH 8.0 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
MGSSHHHHHHSSGLVPRGSHMQSFGAVCKEPQEEVVPGGGRSKRDPDLYQLLQRLFKSHSSLEGL LKALSQASTDPKESTSPEKRDMHDFFVGLMGKRSVQPDSPTDVNQENVPSFGILKYPPRAE
|
| Background |
Tachykinin 3 (TAC3) is a secreted protein that belongs to the Tachykinin family. Tachykinins are active peptides that excite neurons and evoke behavioral responses; they are potent vasodilators and secretagogues, and contract many smooth muscles in pregnancy. TAC3 is primarily expressed in the central and peripheral nervous systems and functions as a neurotransmitter. It is also expressed in the outer syncytiotrophoblast of the placenta and may be associated with pregnancy-induced hypertension and pre-eclampsia. TAC3 acts as the ligand for the neurokinin-3 receptor, mutations in this gene are associated with normosmic hypogonadotropic hypogonadism. |
