| Catalog# |
C529 |
| Source |
Human Cells |
| Description |
Recombinant Human Plexin Domain-Containing Protein 1/PLXDC1 produced by transfected human cells is a secreted protein with sequence (Leu19 Thr426) of human PLXDC1/TEM7 fused with a polyhistidine tag at the C-terminus. |
| Names |
Plexin Domain-Containing Protein 1, Tumor Endothelial Marker 3, Tumor Endothelial Marker 7, PLXDC1, TEM3, TEM7 |
| Accession # |
Q8IUK5 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 5% Threhalose, pH 7.2 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
LSPQPGAGHDEGPGSGWAAKGTVRGWNRRARESPGHVSEPDRTQLSQDLGGGTLAMDTLPDNRTR VVEDNHSYYVSRLYGPSEPHSRELWVDVAEANRSQVKIHTILSNTHRQASRVVLSFDFPFYGHPL RQITMATGGFIFMGDVIHRMLTATQYVAPLMANFNPGYSDNSTVVYFDNGTVFVVQWDHVYLQGW EDKGSFTFQAALHHDGRIVFAYKEIPMSVPEISSSQHPVKTGLSDAFMILNPSPDVPESRRRSIF EYHRIELDPSKVTSMSAVEFTPLPTCLQHRSCDACMSSDLTFNCSWCHVLQRCSSGFDRYRQEWM DYGCAQEAEGRMCEDFQDEDHDSASPDTSFSPYDGDLTTTSSSLFIDSLTTEDDTKLNPYAGGDG LQNNLSPKTKGTPVHLGTVDHHHHHH
|
| Background |
Plexin Domain-Containing Protein 1 (PLXDC1) is a single-pass type I membrane protein that belongs to the plexin family. Secreted PLXDC1 is localized predominantly at the tight junctions of vascular endothelial cells and to a lesser extent at the luminal surface of vascular endothelial cells. PLXDC1 is expressed in fibrovascular membrane with increased expression in individuals with proliferative diabetic retinopathy. It can detect in endothelial cells from colorectal cancer, and in endothelial cells from primary cancers of the lung, liver, pancreas, breast and brain. PLXDC1 interacts with NID1 and may also interact with CTTN. It plays a important role in endothelial cell capillary morphogenesis, the proliferation and maintenance of neovascular endothelial cells in the formation of fibrovascular membranes (FVMs). |
