| Catalog# |
C178 |
| Source |
E.coli |
| Description |
Recombinant Human Transforming Growth Factor α/TGF-α is produced with our E. coli expression system. The target protein is expressed with sequence (Val40-Val89) of Human TGF-α. |
| Names |
Protransforming Growth Factor Alpha, TGF-Alpha, EGF-Like TGF, ETGF, TGF Type 1, TGFA |
| Accession # |
P01135 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 10mM Acetic Acid |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
VSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAV
|
| Background |
Transforming Growth Factor α (TGF-α) belongs to the EGF family of cytokines. It is a mitogenic polypeptide and secreted protein, which is expressed by monocytes, keratinocytes, and various tumor cells. TGFα contains two chains, protransforming growth factor α and transforming growth factor α. It can bind to the EGF receptor that synergistically with TGFβ to stimulate anchorage-independent cell proliferation and produce a mitogenic response. TGFα interacts with the PDZ domains of MAGI3, SDCBP and SNTA1. The interaction with SDCBP is required for the targeting to the cell surface. |
