| Catalog# |
C794 |
| Source |
E. coli |
| Description |
Recombinant Human Protein S100-A8 is produced by our E.coli expression system.The target protein is expressed with sequence (Met1-Glu93) of Human S100A8 fused with a 6His tag at the C-terminus. |
| Names |
Protein S100-A8,S100A8,Calgranulin-A,Cystic fibrosis antigen,Leukocyte L1 complex light chain,MRP-8 |
| Accession # |
P05109 |
| Formulation |
Lyophilized from a 0.2 μM filtered solution of 20mM HEPES,150mM NaCl, pH 7.4 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 3X PBS.
Please aliquot the reconstituted solution_x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000_눀_x0006_Ā |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 5 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGA VNFQEFLILVIKMGVAAHKKSHEESHKEHHHHHH
|
| Background |
Protein S100-A8 (also MRP8 and calgranulin A) is a calcium- and zinc-binding protein.It plays a prominent role in the regulation of inflammatory processes and immune response. S100A8 can induce neutrophil chemotaxis and adhesion. Its role as an oxidant scavenger has a protective role in preventing exaggerated tissue damage by scavenging oxid |